Anti CDC42SE2 pAb (ATL-HPA038624 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA038624-25

• 
• 

Protein Description: CDC42 small effector 2
Gene Name: CDC42SE2
Alternative Gene Name: FLJ21967, SPEC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052298: 100%, ENSRNOG00000042449: 100%
Entrez Gene ID: 56990
Uniprot ID: Q9NRR3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG
• Gene Sequence: EPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG
• Gene ID - Mouse: ENSMUSG00000052298
• Gene ID - Rat: ENSRNOG00000042449
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.