Anti CDC42SE2 pAb (ATL-HPA038624 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA038624-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: CDC42 small effector 2
Gene Name: CDC42SE2
Alternative Gene Name: FLJ21967, SPEC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052298: 100%, ENSRNOG00000042449: 100%
Entrez Gene ID: 56990
Uniprot ID: Q9NRR3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG
Gene Sequence EPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG
Gene ID - Mouse ENSMUSG00000052298
Gene ID - Rat ENSRNOG00000042449
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDC42SE2 pAb (ATL-HPA038624 w/enhanced validation)
Datasheet Anti CDC42SE2 pAb (ATL-HPA038624 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CDC42SE2 pAb (ATL-HPA038624 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CDC42SE2 pAb (ATL-HPA038624 w/enhanced validation)
Datasheet Anti CDC42SE2 pAb (ATL-HPA038624 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CDC42SE2 pAb (ATL-HPA038624 w/enhanced validation)