Anti CDC42EP3 pAb (ATL-HPA061792)

Atlas Antibodies

SKU:
ATL-HPA061792-25
  • Immunofluorescent staining of human cell line LHCN-M2 shows localization to plasma membrane & actin filaments.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: CDC42 effector protein 3
Gene Name: CDC42EP3
Alternative Gene Name: BORG2, CEP3, UB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036533: 94%, ENSRNOG00000032136: 94%
Entrez Gene ID: 10602
Uniprot ID: Q9UKI2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNA
Gene Sequence DISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNA
Gene ID - Mouse ENSMUSG00000036533
Gene ID - Rat ENSRNOG00000032136
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CDC42EP3 pAb (ATL-HPA061792)
Datasheet Anti CDC42EP3 pAb (ATL-HPA061792) Datasheet (External Link)
Vendor Page Anti CDC42EP3 pAb (ATL-HPA061792) at Atlas Antibodies

Documents & Links for Anti CDC42EP3 pAb (ATL-HPA061792)
Datasheet Anti CDC42EP3 pAb (ATL-HPA061792) Datasheet (External Link)
Vendor Page Anti CDC42EP3 pAb (ATL-HPA061792)