Anti CDC42EP3 pAb (ATL-HPA061792)

Atlas Antibodies

Catalog No.: ATL-HPA061792-25

Protein Description: CDC42 effector protein 3
Gene Name: CDC42EP3
Alternative Gene Name: BORG2, CEP3, UB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036533: 94%, ENSRNOG00000032136: 94%
Entrez Gene ID: 10602
Uniprot ID: Q9UKI2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNA
• Gene Sequence: DISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNA
• Gene ID - Mouse: ENSMUSG00000036533
• Gene ID - Rat: ENSRNOG00000032136
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.