Anti CDC42EP3 pAb (ATL-HPA034986 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA034986-25
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and CDC42EP3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY416634).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: CDC42 effector protein (Rho GTPase binding) 3
Gene Name: CDC42EP3
Alternative Gene Name: BORG2, CEP3, UB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036533: 91%, ENSRNOG00000032136: 92%
Entrez Gene ID: 10602
Uniprot ID: Q9UKI2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLPTIGGSQALMLPLLSPVTFNSKQESFGPAKLPRLSCEPVMEEKAQEKSSLLENGTVHQGDTSW
Gene Sequence SLPTIGGSQALMLPLLSPVTFNSKQESFGPAKLPRLSCEPVMEEKAQEKSSLLENGTVHQGDTSW
Gene ID - Mouse ENSMUSG00000036533
Gene ID - Rat ENSRNOG00000032136
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CDC42EP3 pAb (ATL-HPA034986 w/enhanced validation)
Datasheet Anti CDC42EP3 pAb (ATL-HPA034986 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CDC42EP3 pAb (ATL-HPA034986 w/enhanced validation)