Anti CDC42EP2 pAb (ATL-HPA038562 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA038562-25
  • Immunohistochemical staining of human stomach shows string cytoplasmic and membrane positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & microtubules.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and CDC42EP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY416424).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: CDC42 effector protein (Rho GTPase binding) 2
Gene Name: CDC42EP2
Alternative Gene Name: BORG1, CEP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045664: 74%, ENSRNOG00000020904: 76%
Entrez Gene ID: 10435
Uniprot ID: O14613
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PRLHLETPQPSPQEGGSVDIWRIPETGSPNSGLTPESGAEEPFLSNASSLLSLHVDLGPSILDDVLQIMDQDLDSMQI
Gene Sequence PRLHLETPQPSPQEGGSVDIWRIPETGSPNSGLTPESGAEEPFLSNASSLLSLHVDLGPSILDDVLQIMDQDLDSMQI
Gene ID - Mouse ENSMUSG00000045664
Gene ID - Rat ENSRNOG00000020904
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CDC42EP2 pAb (ATL-HPA038562 w/enhanced validation)
Datasheet Anti CDC42EP2 pAb (ATL-HPA038562 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CDC42EP2 pAb (ATL-HPA038562 w/enhanced validation)