Anti CDC42EP2 pAb (ATL-HPA038562 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038562-25

Protein Description: CDC42 effector protein (Rho GTPase binding) 2
Gene Name: CDC42EP2
Alternative Gene Name: BORG1, CEP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045664: 74%, ENSRNOG00000020904: 76%
Entrez Gene ID: 10435
Uniprot ID: O14613
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PRLHLETPQPSPQEGGSVDIWRIPETGSPNSGLTPESGAEEPFLSNASSLLSLHVDLGPSILDDVLQIMDQDLDSMQI
• Gene Sequence: PRLHLETPQPSPQEGGSVDIWRIPETGSPNSGLTPESGAEEPFLSNASSLLSLHVDLGPSILDDVLQIMDQDLDSMQI
• Gene ID - Mouse: ENSMUSG00000045664
• Gene ID - Rat: ENSRNOG00000020904
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.