Anti CDC42EP1 pAb (ATL-HPA076536)

Atlas Antibodies

Catalog No.:
ATL-HPA076536-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: CDC42 effector protein 1
Gene Name: CDC42EP1
Alternative Gene Name: Borg5, CEP1, MSE55
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049521: 61%, ENSRNOG00000008517: 68%
Entrez Gene ID: 11135
Uniprot ID: Q00587
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GAGWDGGHHYPEMDARQERVEVLPQARASWESLDEEWRAPQAGSRTPVPSTVQANTFEFADAEEDDEVKV
Gene Sequence GAGWDGGHHYPEMDARQERVEVLPQARASWESLDEEWRAPQAGSRTPVPSTVQANTFEFADAEEDDEVKV
Gene ID - Mouse ENSMUSG00000049521
Gene ID - Rat ENSRNOG00000008517
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDC42EP1 pAb (ATL-HPA076536)
Datasheet Anti CDC42EP1 pAb (ATL-HPA076536) Datasheet (External Link)
Vendor Page Anti CDC42EP1 pAb (ATL-HPA076536) at Atlas Antibodies

Documents & Links for Anti CDC42EP1 pAb (ATL-HPA076536)
Datasheet Anti CDC42EP1 pAb (ATL-HPA076536) Datasheet (External Link)
Vendor Page Anti CDC42EP1 pAb (ATL-HPA076536)