Anti CDC42BPG pAb (ATL-HPA027382 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA027382-25

• 

Protein Description: CDC42 binding protein kinase gamma (DMPK-like)
Gene Name: CDC42BPG
Alternative Gene Name: DMPK2, HSMDPKIN, kappa-200, MRCKgamma
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000107268: 72%, ENSRNOG00000027456: 71%
Entrez Gene ID: 55561
Uniprot ID: Q6DT37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSNSLIPFLSFRSSEKDSAKDPGISGEATRHGGEPDLRPEGRRSLRMGAVFPRAPTANTASTEGLPAKPGSH
• Gene Sequence: PSNSLIPFLSFRSSEKDSAKDPGISGEATRHGGEPDLRPEGRRSLRMGAVFPRAPTANTASTEGLPAKPGSH
• Gene ID - Mouse: ENSMUSG00000107268
• Gene ID - Rat: ENSRNOG00000027456
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.