Anti CDC42BPB pAb (ATL-HPA022821)

Atlas Antibodies

Catalog No.: ATL-HPA022821-25

Protein Description: CDC42 binding protein kinase beta (DMPK-like)
Gene Name: CDC42BPB
Alternative Gene Name: KIAA1124, MRCKB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021279: 89%, ENSRNOG00000009675: 91%
Entrez Gene ID: 9578
Uniprot ID: Q9Y5S2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSKFSGAVLNVPDTSDNSKKQMLRTRSKRRFVFKVPEEERLQQRREMLRDPELRSKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERPGPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDST
• Gene Sequence: KSKFSGAVLNVPDTSDNSKKQMLRTRSKRRFVFKVPEEERLQQRREMLRDPELRSKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERPGPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDST
• Gene ID - Mouse: ENSMUSG00000021279
• Gene ID - Rat: ENSRNOG00000009675
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CDC42BPB pAb (ATL-HPA022821) – 1 Found

Unbekandt, Mathieu; Belshaw, Simone; Bower, Justin; Clarke, Maeve; Cordes, Jacqueline; Crighton, Diane; Croft, Daniel R; Drysdale, Martin J; Garnett, Mathew J; Gill, Kathryn; Gray, Christopher; Greenhalgh, David A; Hall, James A M; Konczal, Jennifer; Lilla, Sergio; McArthur, Duncan; McConnell, Patricia; McDonald, Laura; McGarry, Lynn; McKinnon, Heather; McMenemy, Carol; Mezna, Mokdad; Morrice, Nicolas A; Munro, June; Naylor, Gregory; Rath, Nicola; Schüttelkopf, Alexander W; Sime, Mairi; Olson, Michael F. Discovery of Potent and Selective MRCK Inhibitors with Therapeutic Effect on Skin Cancer. Cancer Research. 2018;78(8):2096-2114.