Anti CDC42BPA pAb (ATL-HPA071252)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071252-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CDC42BPA
Alternative Gene Name: FLJ23347, KIAA0451, MRCK, MRCKA, PK428
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026490: 90%, ENSRNOG00000002841: 90%
Entrez Gene ID: 8476
Uniprot ID: Q5VT25
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TRRESQSEREEFESEFKQQYEREKVLLTEENKKLTSELDKLTTLYENLSIHNQQLEEEVKD |
| Gene Sequence | TRRESQSEREEFESEFKQQYEREKVLLTEENKKLTSELDKLTTLYENLSIHNQQLEEEVKD |
| Gene ID - Mouse | ENSMUSG00000026490 |
| Gene ID - Rat | ENSRNOG00000002841 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDC42BPA pAb (ATL-HPA071252) | |
| Datasheet | Anti CDC42BPA pAb (ATL-HPA071252) Datasheet (External Link) |
| Vendor Page | Anti CDC42BPA pAb (ATL-HPA071252) at Atlas Antibodies |
| Documents & Links for Anti CDC42BPA pAb (ATL-HPA071252) | |
| Datasheet | Anti CDC42BPA pAb (ATL-HPA071252) Datasheet (External Link) |
| Vendor Page | Anti CDC42BPA pAb (ATL-HPA071252) |