Anti CDC40 pAb (ATL-HPA046620)

Atlas Antibodies

Catalog No.:
ATL-HPA046620-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cell division cycle 40
Gene Name: CDC40
Alternative Gene Name: EHB3, FLJ10564, PRP17, PRPF17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038446: 100%, ENSRNOG00000000581: 73%
Entrez Gene ID: 51362
Uniprot ID: O60508
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKT
Gene Sequence VQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKT
Gene ID - Mouse ENSMUSG00000038446
Gene ID - Rat ENSRNOG00000000581
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDC40 pAb (ATL-HPA046620)
Datasheet Anti CDC40 pAb (ATL-HPA046620) Datasheet (External Link)
Vendor Page Anti CDC40 pAb (ATL-HPA046620) at Atlas Antibodies

Documents & Links for Anti CDC40 pAb (ATL-HPA046620)
Datasheet Anti CDC40 pAb (ATL-HPA046620) Datasheet (External Link)
Vendor Page Anti CDC40 pAb (ATL-HPA046620)