Anti CDC37L1 pAb (ATL-HPA021175 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA021175-25

• 
• 
• 

Protein Description: cell division cycle 37-like 1
Gene Name: CDC37L1
Alternative Gene Name: CDC37B, FLJ20639, HARC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024780: 92%, ENSRNOG00000010967: 92%
Entrez Gene ID: 55664
Uniprot ID: Q7L3B6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LHNSESLDQEHAKAQTAVSELRQREEEWRQKEEALVQREKMCLWSTDAISKDVFNKSFINQDKRKDTEDEDKSE
• Gene Sequence: LHNSESLDQEHAKAQTAVSELRQREEEWRQKEEALVQREKMCLWSTDAISKDVFNKSFINQDKRKDTEDEDKSE
• Gene ID - Mouse: ENSMUSG00000024780
• Gene ID - Rat: ENSRNOG00000010967
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.