Anti CDC27 pAb (ATL-HPA052399)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052399-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CDC27
Alternative Gene Name: ANAPC3, APC3, D0S1430E, D17S978E, NUC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020687: 100%, ENSRNOG00000005904: 100%
Entrez Gene ID: 996
Uniprot ID: P30260
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKS |
Gene Sequence | AIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKS |
Gene ID - Mouse | ENSMUSG00000020687 |
Gene ID - Rat | ENSRNOG00000005904 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CDC27 pAb (ATL-HPA052399) | |
Datasheet | Anti CDC27 pAb (ATL-HPA052399) Datasheet (External Link) |
Vendor Page | Anti CDC27 pAb (ATL-HPA052399) at Atlas Antibodies |
Documents & Links for Anti CDC27 pAb (ATL-HPA052399) | |
Datasheet | Anti CDC27 pAb (ATL-HPA052399) Datasheet (External Link) |
Vendor Page | Anti CDC27 pAb (ATL-HPA052399) |