Anti CDC27 pAb (ATL-HPA052399)

Atlas Antibodies

Catalog No.:
ATL-HPA052399-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: cell division cycle 27
Gene Name: CDC27
Alternative Gene Name: ANAPC3, APC3, D0S1430E, D17S978E, NUC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020687: 100%, ENSRNOG00000005904: 100%
Entrez Gene ID: 996
Uniprot ID: P30260
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKS
Gene Sequence AIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKS
Gene ID - Mouse ENSMUSG00000020687
Gene ID - Rat ENSRNOG00000005904
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDC27 pAb (ATL-HPA052399)
Datasheet Anti CDC27 pAb (ATL-HPA052399) Datasheet (External Link)
Vendor Page Anti CDC27 pAb (ATL-HPA052399) at Atlas Antibodies

Documents & Links for Anti CDC27 pAb (ATL-HPA052399)
Datasheet Anti CDC27 pAb (ATL-HPA052399) Datasheet (External Link)
Vendor Page Anti CDC27 pAb (ATL-HPA052399)