Anti CDC27 pAb (ATL-HPA028129 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA028129-25
  • Immunohistochemical staining of human bronchus shows strong nuclear positivity in respiratory epithelial cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
  • Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CDC27 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: cell division cycle 27
Gene Name: CDC27
Alternative Gene Name: ANAPC3, APC3, D0S1430E, D17S978E, NUC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020687: 100%, ENSRNOG00000005904: 100%
Entrez Gene ID: 996
Uniprot ID: P30260
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMG
Gene Sequence YKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMG
Gene ID - Mouse ENSMUSG00000020687
Gene ID - Rat ENSRNOG00000005904
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CDC27 pAb (ATL-HPA028129 w/enhanced validation)
Datasheet Anti CDC27 pAb (ATL-HPA028129 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CDC27 pAb (ATL-HPA028129 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CDC27 pAb (ATL-HPA028129 w/enhanced validation)
Datasheet Anti CDC27 pAb (ATL-HPA028129 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CDC27 pAb (ATL-HPA028129 w/enhanced validation)



Citations for Anti CDC27 pAb (ATL-HPA028129 w/enhanced validation) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed