Anti CDC26 pAb (ATL-HPA044130)

Atlas Antibodies

Catalog No.: ATL-HPA044130-25

Protein Description: cell division cycle 26
Gene Name: CDC26
Alternative Gene Name: ANAPC12, APC12, C9orf17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066149: 88%, ENSRNOG00000029785: 89%
Entrez Gene ID: 246184
Uniprot ID: Q8NHZ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSL
• Gene Sequence: MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSL
• Gene ID - Mouse: ENSMUSG00000066149
• Gene ID - Rat: ENSRNOG00000029785
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.