Anti CDC23 pAb (ATL-HPA039593)

Atlas Antibodies

Catalog No.:
ATL-HPA039593-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: cell division cycle 23
Gene Name: CDC23
Alternative Gene Name: ANAPC8, APC8, CUT23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024370: 96%, ENSRNOG00000024241: 96%
Entrez Gene ID: 8697
Uniprot ID: Q9UJX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AELAFSLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVD
Gene Sequence AELAFSLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVD
Gene ID - Mouse ENSMUSG00000024370
Gene ID - Rat ENSRNOG00000024241
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDC23 pAb (ATL-HPA039593)
Datasheet Anti CDC23 pAb (ATL-HPA039593) Datasheet (External Link)
Vendor Page Anti CDC23 pAb (ATL-HPA039593) at Atlas Antibodies

Documents & Links for Anti CDC23 pAb (ATL-HPA039593)
Datasheet Anti CDC23 pAb (ATL-HPA039593) Datasheet (External Link)
Vendor Page Anti CDC23 pAb (ATL-HPA039593)
Citations for Anti CDC23 pAb (ATL-HPA039593) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed