Anti CDC23 pAb (ATL-HPA039593)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039593-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CDC23
Alternative Gene Name: ANAPC8, APC8, CUT23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024370: 96%, ENSRNOG00000024241: 96%
Entrez Gene ID: 8697
Uniprot ID: Q9UJX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AELAFSLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVD |
Gene Sequence | AELAFSLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVD |
Gene ID - Mouse | ENSMUSG00000024370 |
Gene ID - Rat | ENSRNOG00000024241 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CDC23 pAb (ATL-HPA039593) | |
Datasheet | Anti CDC23 pAb (ATL-HPA039593) Datasheet (External Link) |
Vendor Page | Anti CDC23 pAb (ATL-HPA039593) at Atlas Antibodies |
Documents & Links for Anti CDC23 pAb (ATL-HPA039593) | |
Datasheet | Anti CDC23 pAb (ATL-HPA039593) Datasheet (External Link) |
Vendor Page | Anti CDC23 pAb (ATL-HPA039593) |
Citations for Anti CDC23 pAb (ATL-HPA039593) – 1 Found |
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |