Anti CDC20 pAb (ATL-HPA055288 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA055288-25

Protein Description: cell division cycle 20
Gene Name: CDC20
Alternative Gene Name: CDC20A, p55CDC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006398: 99%, ENSRNOG00000028415: 98%
Entrez Gene ID: 991
Uniprot ID: Q12834
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDY
• Gene Sequence: TPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDY
• Gene ID - Mouse: ENSMUSG00000006398
• Gene ID - Rat: ENSRNOG00000028415
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CDC20 pAb (ATL-HPA055288 w/enhanced validation) – 1 Found

Shen, Peilin; He, Xuejun; Lan, Lin; Hong, Yingkai; Lin, Mingen. Identification of cell division cycle 20 as a candidate biomarker and potential therapeutic target in bladder cancer using bioinformatics analysis. Bioscience Reports. 2020;40(7)