Anti CDC16 pAb (ATL-HPA042826)

Atlas Antibodies

SKU: ATL-HPA042826-25

• 
• 

Protein Description: cell division cycle 16
Gene Name: CDC16
Alternative Gene Name: ANAPC6, APC6, CUT9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038416: 87%, ENSRNOG00000017536: 89%
Entrez Gene ID: 8881
Uniprot ID: Q13042
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KDKLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST
• Gene Sequence: KDKLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST
• Gene ID - Mouse: ENSMUSG00000038416
• Gene ID - Rat: ENSRNOG00000017536
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.