Anti CDC14B pAb (ATL-HPA064747)

Atlas Antibodies

Catalog No.:
ATL-HPA064747-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: cell division cycle 14B
Gene Name: CDC14B
Alternative Gene Name: Cdc14B1, Cdc14B2, CDC14B3, hCDC14B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033102: 76%, ENSRNOG00000018999: 78%
Entrez Gene ID: 8555
Uniprot ID: O60729
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAILYSRPKSASNVHY
Gene Sequence RCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAILYSRPKSASNVHY
Gene ID - Mouse ENSMUSG00000033102
Gene ID - Rat ENSRNOG00000018999
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDC14B pAb (ATL-HPA064747)
Datasheet Anti CDC14B pAb (ATL-HPA064747) Datasheet (External Link)
Vendor Page Anti CDC14B pAb (ATL-HPA064747) at Atlas Antibodies

Documents & Links for Anti CDC14B pAb (ATL-HPA064747)
Datasheet Anti CDC14B pAb (ATL-HPA064747) Datasheet (External Link)
Vendor Page Anti CDC14B pAb (ATL-HPA064747)