Anti CDC14B pAb (ATL-HPA064747)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064747-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CDC14B
Alternative Gene Name: Cdc14B1, Cdc14B2, CDC14B3, hCDC14B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033102: 76%, ENSRNOG00000018999: 78%
Entrez Gene ID: 8555
Uniprot ID: O60729
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAILYSRPKSASNVHY |
| Gene Sequence | RCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAILYSRPKSASNVHY |
| Gene ID - Mouse | ENSMUSG00000033102 |
| Gene ID - Rat | ENSRNOG00000018999 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDC14B pAb (ATL-HPA064747) | |
| Datasheet | Anti CDC14B pAb (ATL-HPA064747) Datasheet (External Link) |
| Vendor Page | Anti CDC14B pAb (ATL-HPA064747) at Atlas Antibodies |
| Documents & Links for Anti CDC14B pAb (ATL-HPA064747) | |
| Datasheet | Anti CDC14B pAb (ATL-HPA064747) Datasheet (External Link) |
| Vendor Page | Anti CDC14B pAb (ATL-HPA064747) |