Anti CDC123 pAb (ATL-HPA057540)

Atlas Antibodies

Catalog No.: ATL-HPA057540-25

Protein Description: cell division cycle 123
Gene Name: CDC123
Alternative Gene Name: C10orf7, D123
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039128: 89%, ENSRNOG00000017770: 93%
Entrez Gene ID: 8872
Uniprot ID: O75794
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSLLFTWEELISENNLNGDFSEVDAQEQDSPAFRCTNSEVTVQPSPYLSYRLPKDFVDLSTGEDAHKLIDFLKLKRNQQEDD
• Gene Sequence: DSLLFTWEELISENNLNGDFSEVDAQEQDSPAFRCTNSEVTVQPSPYLSYRLPKDFVDLSTGEDAHKLIDFLKLKRNQQEDD
• Gene ID - Mouse: ENSMUSG00000039128
• Gene ID - Rat: ENSRNOG00000017770
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.