Anti CDC123 pAb (ATL-HPA057540)

Atlas Antibodies

Catalog No.:
ATL-HPA057540-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: cell division cycle 123
Gene Name: CDC123
Alternative Gene Name: C10orf7, D123
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039128: 89%, ENSRNOG00000017770: 93%
Entrez Gene ID: 8872
Uniprot ID: O75794
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DSLLFTWEELISENNLNGDFSEVDAQEQDSPAFRCTNSEVTVQPSPYLSYRLPKDFVDLSTGEDAHKLIDFLKLKRNQQEDD
Gene Sequence DSLLFTWEELISENNLNGDFSEVDAQEQDSPAFRCTNSEVTVQPSPYLSYRLPKDFVDLSTGEDAHKLIDFLKLKRNQQEDD
Gene ID - Mouse ENSMUSG00000039128
Gene ID - Rat ENSRNOG00000017770
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDC123 pAb (ATL-HPA057540)
Datasheet Anti CDC123 pAb (ATL-HPA057540) Datasheet (External Link)
Vendor Page Anti CDC123 pAb (ATL-HPA057540) at Atlas Antibodies

Documents & Links for Anti CDC123 pAb (ATL-HPA057540)
Datasheet Anti CDC123 pAb (ATL-HPA057540) Datasheet (External Link)
Vendor Page Anti CDC123 pAb (ATL-HPA057540)