Anti CDAN1 pAb (ATL-HPA040787 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA040787-100
  • Immunohistochemistry analysis in human fallopian tube and skeletal muscle tissues using HPA040787 antibody. Corresponding CDAN1 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line HeLa shows localization to plasma membrane & cytosol.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and CDAN1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408581).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: codanin 1
Gene Name: CDAN1
Alternative Gene Name: CDA-I, CDAI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027284: 87%, ENSRNOG00000047427: 86%
Entrez Gene ID: 146059
Uniprot ID: Q8IWY9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QYRLERGQARRLLHMLLSLWKEDFQGPVPLQLLLSPRNVGLLADTRPREWDLLLFLLRELVEKGLMGRMEIEACLGSLHQAQWPGDFAEELATLSNLFLAEPH
Gene Sequence QYRLERGQARRLLHMLLSLWKEDFQGPVPLQLLLSPRNVGLLADTRPREWDLLLFLLRELVEKGLMGRMEIEACLGSLHQAQWPGDFAEELATLSNLFLAEPH
Gene ID - Mouse ENSMUSG00000027284
Gene ID - Rat ENSRNOG00000047427
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CDAN1 pAb (ATL-HPA040787 w/enhanced validation)
Datasheet Anti CDAN1 pAb (ATL-HPA040787 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CDAN1 pAb (ATL-HPA040787 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CDAN1 pAb (ATL-HPA040787 w/enhanced validation)
Datasheet Anti CDAN1 pAb (ATL-HPA040787 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CDAN1 pAb (ATL-HPA040787 w/enhanced validation)