Anti CDADC1 pAb (ATL-HPA058314)

Atlas Antibodies

SKU:
ATL-HPA058314-25
  • Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in subset of germinal and non-germinal center cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cytidine and dCMP deaminase domain containing 1
Gene Name: CDADC1
Alternative Gene Name: NYD-SP15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021982: 91%, ENSRNOG00000012209: 93%
Entrez Gene ID: 81602
Uniprot ID: Q9BWV3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LKSNSRAHVCVLLQPLVCYMVQFVEETSYKCDFIQKITKTLPDANTDFYYECKQERIKEYEMLFLVSNEEMHKQILMTIGLENLCE
Gene Sequence LKSNSRAHVCVLLQPLVCYMVQFVEETSYKCDFIQKITKTLPDANTDFYYECKQERIKEYEMLFLVSNEEMHKQILMTIGLENLCE
Gene ID - Mouse ENSMUSG00000021982
Gene ID - Rat ENSRNOG00000012209
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CDADC1 pAb (ATL-HPA058314)
Datasheet Anti CDADC1 pAb (ATL-HPA058314) Datasheet (External Link)
Vendor Page Anti CDADC1 pAb (ATL-HPA058314) at Atlas Antibodies

Documents & Links for Anti CDADC1 pAb (ATL-HPA058314)
Datasheet Anti CDADC1 pAb (ATL-HPA058314) Datasheet (External Link)
Vendor Page Anti CDADC1 pAb (ATL-HPA058314)