Anti CDADC1 pAb (ATL-HPA047615)

Atlas Antibodies

SKU: ATL-HPA047615-25

• 

Protein Description: cytidine and dCMP deaminase domain containing 1
Gene Name: CDADC1
Alternative Gene Name: NYD-SP15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021982: 94%, ENSRNOG00000012209: 37%
Entrez Gene ID: 81602
Uniprot ID: Q9BWV3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HFGFYRSNPEQINEIHNQSLPQEIARHCMVQARLLAYRTEDHKTGVGAVIWAEGKSRSCDGTGAMYFVGCGYNAFPVGSEYADFPHMDDKQKDREIRKFRY
• Gene Sequence: HFGFYRSNPEQINEIHNQSLPQEIARHCMVQARLLAYRTEDHKTGVGAVIWAEGKSRSCDGTGAMYFVGCGYNAFPVGSEYADFPHMDDKQKDREIRKFRY
• Gene ID - Mouse: ENSMUSG00000021982
• Gene ID - Rat: ENSRNOG00000012209
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.