Anti CD99L2 pAb (ATL-HPA061400)

Atlas Antibodies

Catalog No.:
ATL-HPA061400-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: CD99 molecule like 2
Gene Name: CD99L2
Alternative Gene Name: CD99B, MIC2L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035776: 91%, ENSRNOG00000023841: 57%
Entrez Gene ID: 83692
Uniprot ID: Q8TCZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QQKKFCFSIQQGLNADYVKGENLEAVVCEEPQVKYSTLHTQSAEPP
Gene Sequence QQKKFCFSIQQGLNADYVKGENLEAVVCEEPQVKYSTLHTQSAEPP
Gene ID - Mouse ENSMUSG00000035776
Gene ID - Rat ENSRNOG00000023841
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CD99L2 pAb (ATL-HPA061400)
Datasheet Anti CD99L2 pAb (ATL-HPA061400) Datasheet (External Link)
Vendor Page Anti CD99L2 pAb (ATL-HPA061400) at Atlas Antibodies

Documents & Links for Anti CD99L2 pAb (ATL-HPA061400)
Datasheet Anti CD99L2 pAb (ATL-HPA061400) Datasheet (External Link)
Vendor Page Anti CD99L2 pAb (ATL-HPA061400)