Anti CD99L2 pAb (ATL-HPA061400)

Atlas Antibodies

Catalog No.: ATL-HPA061400-25

Protein Description: CD99 molecule like 2
Gene Name: CD99L2
Alternative Gene Name: CD99B, MIC2L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035776: 91%, ENSRNOG00000023841: 57%
Entrez Gene ID: 83692
Uniprot ID: Q8TCZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QQKKFCFSIQQGLNADYVKGENLEAVVCEEPQVKYSTLHTQSAEPP
• Gene Sequence: QQKKFCFSIQQGLNADYVKGENLEAVVCEEPQVKYSTLHTQSAEPP
• Gene ID - Mouse: ENSMUSG00000035776
• Gene ID - Rat: ENSRNOG00000023841
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.