Anti CD99 pAb (ATL-HPA035304 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA035304-100

• 
• 

Protein Description: CD99 molecule
Gene Name: CD99
Alternative Gene Name: MIC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051331: 34%, ENSRNOG00000007090: 34%
Entrez Gene ID: 4267
Uniprot ID: P14209
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLL
• Gene Sequence: SSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLL
• Gene ID - Mouse: ENSMUSG00000051331
• Gene ID - Rat: ENSRNOG00000007090
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CD99 pAb (ATL-HPA035304 w/enhanced validation) – 2 Found

Yang, Bao; Yang, Chenlong; Fang, Jingyi; Yang, Jun; Xu, Yulun. Clinicoradiological characteristics, management and prognosis of primary myeloid sarcoma of the central nervous system: A report of four cases. Oncology Letters. 2017;14(3):3825-3831. 

Edlund, Karolina; Lindskog, Cecilia; Saito, Akira; Berglund, Anders; Pontén, Fredrik; Göransson-Kultima, Hanna; Isaksson, Anders; Jirström, Karin; Planck, Maria; Johansson, Leif; Lambe, Mats; Holmberg, Lars; Nyberg, Fredrik; Ekman, Simon; Bergqvist, Michael; Landelius, Per; Lamberg, Kristina; Botling, Johan; Ostman, Arne; Micke, Patrick. CD99 is a novel prognostic stromal marker in non-small cell lung cancer. International Journal Of Cancer. 2012;131(10):2264-73.