Anti CD96 pAb (ATL-HPA066754 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA066754-25
  • Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using HPA066754 antibody. Corresponding CD96 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: CD96 molecule
Gene Name: CD96
Alternative Gene Name: TACTILE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022657: 54%, ENSRNOG00000023030: 56%
Entrez Gene ID: 10225
Uniprot ID: P40200
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VPGNKVWNISSEKITFLLGSEISSTDPPLSVTESTLDTQPSPASSVSPARYPATSSVTLVDVSALRPNTTPQPSNSSMTT
Gene Sequence VPGNKVWNISSEKITFLLGSEISSTDPPLSVTESTLDTQPSPASSVSPARYPATSSVTLVDVSALRPNTTPQPSNSSMTT
Gene ID - Mouse ENSMUSG00000022657
Gene ID - Rat ENSRNOG00000023030
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CD96 pAb (ATL-HPA066754 w/enhanced validation)
Datasheet Anti CD96 pAb (ATL-HPA066754 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD96 pAb (ATL-HPA066754 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CD96 pAb (ATL-HPA066754 w/enhanced validation)
Datasheet Anti CD96 pAb (ATL-HPA066754 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD96 pAb (ATL-HPA066754 w/enhanced validation)