Anti CD93 pAb (ATL-HPA012368 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA012368-25

Protein Description: CD93 molecule
Gene Name: CD93
Alternative Gene Name: C1qR(P), C1QR1, C1qRP, CDw93, dJ737E23.1, ECSM3, MXRA4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027435: 65%, ENSRNOG00000004687: 28%
Entrez Gene ID: 22918
Uniprot ID: Q9NPY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFS
• Gene Sequence: HVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFS
• Gene ID - Mouse: ENSMUSG00000027435
• Gene ID - Rat: ENSRNOG00000004687
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.