Anti CD8B pAb (ATL-HPA029164)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029164-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CD8B
Alternative Gene Name: CD8B1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041730: 34%, ENSRNOG00000001915: 34%
Entrez Gene ID: 926
Uniprot ID: P10966
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EGISGTFVPQCLHGYYSNTTTSQKLLNPWILK |
Gene Sequence | EGISGTFVPQCLHGYYSNTTTSQKLLNPWILK |
Gene ID - Mouse | ENSMUSG00000041730 |
Gene ID - Rat | ENSRNOG00000001915 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CD8B pAb (ATL-HPA029164) | |
Datasheet | Anti CD8B pAb (ATL-HPA029164) Datasheet (External Link) |
Vendor Page | Anti CD8B pAb (ATL-HPA029164) at Atlas Antibodies |
Documents & Links for Anti CD8B pAb (ATL-HPA029164) | |
Datasheet | Anti CD8B pAb (ATL-HPA029164) Datasheet (External Link) |
Vendor Page | Anti CD8B pAb (ATL-HPA029164) |