Anti CD8B pAb (ATL-HPA029164)

Atlas Antibodies

Catalog No.:
ATL-HPA029164-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: CD8b molecule
Gene Name: CD8B
Alternative Gene Name: CD8B1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041730: 34%, ENSRNOG00000001915: 34%
Entrez Gene ID: 926
Uniprot ID: P10966
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EGISGTFVPQCLHGYYSNTTTSQKLLNPWILK
Gene Sequence EGISGTFVPQCLHGYYSNTTTSQKLLNPWILK
Gene ID - Mouse ENSMUSG00000041730
Gene ID - Rat ENSRNOG00000001915
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CD8B pAb (ATL-HPA029164)
Datasheet Anti CD8B pAb (ATL-HPA029164) Datasheet (External Link)
Vendor Page Anti CD8B pAb (ATL-HPA029164) at Atlas Antibodies

Documents & Links for Anti CD8B pAb (ATL-HPA029164)
Datasheet Anti CD8B pAb (ATL-HPA029164) Datasheet (External Link)
Vendor Page Anti CD8B pAb (ATL-HPA029164)