Anti CD8A pAb (ATL-HPA037756 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037756-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: CD8A
Alternative Gene Name: CD8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053977: 46%, ENSRNOG00000007178: 44%
Entrez Gene ID: 925
Uniprot ID: P01732
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPT |
| Gene Sequence | AASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPT |
| Gene ID - Mouse | ENSMUSG00000053977 |
| Gene ID - Rat | ENSRNOG00000007178 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CD8A pAb (ATL-HPA037756 w/enhanced validation) | |
| Datasheet | Anti CD8A pAb (ATL-HPA037756 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD8A pAb (ATL-HPA037756 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CD8A pAb (ATL-HPA037756 w/enhanced validation) | |
| Datasheet | Anti CD8A pAb (ATL-HPA037756 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD8A pAb (ATL-HPA037756 w/enhanced validation) |
| Citations for Anti CD8A pAb (ATL-HPA037756 w/enhanced validation) – 5 Found |
| Mangus, Lisa M; Beck, Sarah E; Queen, Suzanne E; Brill, Samuel A; Shirk, Erin N; Metcalf Pate, Kelly A; Muth, Dillon C; Adams, Robert J; Gama, Lucio; Clements, Janice E; Mankowski, Joseph L. Lymphocyte-Dominant Encephalitis and Meningitis in Simian Immunodeficiency Virus-Infected Macaques Receiving Antiretroviral Therapy. The American Journal Of Pathology. 2018;188(1):125-134. PubMed |
| Yanguas, Alba; Garasa, Saray; Teijeira, Álvaro; Aubá, Cristina; Melero, Ignacio; Rouzaut, Ana. ICAM-1-LFA-1 Dependent CD8+ T-Lymphocyte Aggregation in Tumor Tissue Prevents Recirculation to Draining Lymph Nodes. Frontiers In Immunology. 9( 30258446):2084. PubMed |
| Okoye, Afam A; Duell, Derick D; Fukazawa, Yoshinori; Varco-Merth, Benjamin; Marenco, Alejandra; Behrens, Hannah; Chaunzwa, Morgan; Selseth, Andrea N; Gilbride, Roxanne M; Shao, Jason; Edlefsen, Paul T; Geleziunas, Romas; Pinkevych, Mykola; Davenport, Miles P; Busman-Sahay, Kathleen; Nekorchuk, Michael; Park, Haesun; Smedley, Jeremy; Axthelm, Michael K; Estes, Jacob D; Hansen, Scott G; Keele, Brandon F; Lifson, Jeffery D; Picker, Louis J. CD8+ T cells fail to limit SIV reactivation following ART withdrawal until after viral amplification. The Journal Of Clinical Investigation. 2021;131(8) PubMed |
| Schwabenland, Marius; Salié, Henrike; Tanevski, Jovan; Killmer, Saskia; Lago, Marilyn Salvat; Schlaak, Alexandra Emilia; Mayer, Lena; Matschke, Jakob; Püschel, Klaus; Fitzek, Antonia; Ondruschka, Benjamin; Mei, Henrik E; Boettler, Tobias; Neumann-Haefelin, Christoph; Hofmann, Maike; Breithaupt, Angele; Genc, Nafiye; Stadelmann, Christine; Saez-Rodriguez, Julio; Bronsert, Peter; Knobeloch, Klaus-Peter; Blank, Thomas; Thimme, Robert; Glatzel, Markus; Prinz, Marco; Bengsch, Bertram. Deep spatial profiling of human COVID-19 brains reveals neuroinflammation with distinct microanatomical microglia-T-cell interactions. Immunity. 2021;54(7):1594-1610.e11. PubMed |
| Andersson, Sandra; Nilsson, Kenneth; Fagerberg, Linn; Hallström, Björn M; Sundström, Christer; Danielsson, Angelika; Edlund, Karolina; Uhlen, Mathias; Asplund, Anna. The transcriptomic and proteomic landscapes of bone marrow and secondary lymphoid tissues. Plos One. 9(12):e115911. PubMed |