Anti CD8A pAb (ATL-HPA037756 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA037756-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: CD8a molecule
Gene Name: CD8A
Alternative Gene Name: CD8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053977: 46%, ENSRNOG00000007178: 44%
Entrez Gene ID: 925
Uniprot ID: P01732
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPT
Gene Sequence AASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPT
Gene ID - Mouse ENSMUSG00000053977
Gene ID - Rat ENSRNOG00000007178
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CD8A pAb (ATL-HPA037756 w/enhanced validation)
Datasheet Anti CD8A pAb (ATL-HPA037756 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD8A pAb (ATL-HPA037756 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CD8A pAb (ATL-HPA037756 w/enhanced validation)
Datasheet Anti CD8A pAb (ATL-HPA037756 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD8A pAb (ATL-HPA037756 w/enhanced validation)
Citations for Anti CD8A pAb (ATL-HPA037756 w/enhanced validation) – 5 Found
Mangus, Lisa M; Beck, Sarah E; Queen, Suzanne E; Brill, Samuel A; Shirk, Erin N; Metcalf Pate, Kelly A; Muth, Dillon C; Adams, Robert J; Gama, Lucio; Clements, Janice E; Mankowski, Joseph L. Lymphocyte-Dominant Encephalitis and Meningitis in Simian Immunodeficiency Virus-Infected Macaques Receiving Antiretroviral Therapy. The American Journal Of Pathology. 2018;188(1):125-134.  PubMed
Yanguas, Alba; Garasa, Saray; Teijeira, Álvaro; Aubá, Cristina; Melero, Ignacio; Rouzaut, Ana. ICAM-1-LFA-1 Dependent CD8+ T-Lymphocyte Aggregation in Tumor Tissue Prevents Recirculation to Draining Lymph Nodes. Frontiers In Immunology. 9( 30258446):2084.  PubMed
Okoye, Afam A; Duell, Derick D; Fukazawa, Yoshinori; Varco-Merth, Benjamin; Marenco, Alejandra; Behrens, Hannah; Chaunzwa, Morgan; Selseth, Andrea N; Gilbride, Roxanne M; Shao, Jason; Edlefsen, Paul T; Geleziunas, Romas; Pinkevych, Mykola; Davenport, Miles P; Busman-Sahay, Kathleen; Nekorchuk, Michael; Park, Haesun; Smedley, Jeremy; Axthelm, Michael K; Estes, Jacob D; Hansen, Scott G; Keele, Brandon F; Lifson, Jeffery D; Picker, Louis J. CD8+ T cells fail to limit SIV reactivation following ART withdrawal until after viral amplification. The Journal Of Clinical Investigation. 2021;131(8)  PubMed
Schwabenland, Marius; Salié, Henrike; Tanevski, Jovan; Killmer, Saskia; Lago, Marilyn Salvat; Schlaak, Alexandra Emilia; Mayer, Lena; Matschke, Jakob; Püschel, Klaus; Fitzek, Antonia; Ondruschka, Benjamin; Mei, Henrik E; Boettler, Tobias; Neumann-Haefelin, Christoph; Hofmann, Maike; Breithaupt, Angele; Genc, Nafiye; Stadelmann, Christine; Saez-Rodriguez, Julio; Bronsert, Peter; Knobeloch, Klaus-Peter; Blank, Thomas; Thimme, Robert; Glatzel, Markus; Prinz, Marco; Bengsch, Bertram. Deep spatial profiling of human COVID-19 brains reveals neuroinflammation with distinct microanatomical microglia-T-cell interactions. Immunity. 2021;54(7):1594-1610.e11.  PubMed
Andersson, Sandra; Nilsson, Kenneth; Fagerberg, Linn; Hallström, Björn M; Sundström, Christer; Danielsson, Angelika; Edlund, Karolina; Uhlen, Mathias; Asplund, Anna. The transcriptomic and proteomic landscapes of bone marrow and secondary lymphoid tissues. Plos One. 9(12):e115911.  PubMed