Anti CD86 pAb (ATL-HPA026802)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026802-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: CD86
Alternative Gene Name: B7-2, B7.2, CD28LG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022185: 42%, ENSRNOG00000013533: 42%
Entrez Gene ID: 942
Uniprot ID: P42081
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GTNTMEREESEQTKKREKIHIPERSDEAQRV |
| Gene Sequence | GTNTMEREESEQTKKREKIHIPERSDEAQRV |
| Gene ID - Mouse | ENSMUSG00000022185 |
| Gene ID - Rat | ENSRNOG00000013533 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CD86 pAb (ATL-HPA026802) | |
| Datasheet | Anti CD86 pAb (ATL-HPA026802) Datasheet (External Link) |
| Vendor Page | Anti CD86 pAb (ATL-HPA026802) at Atlas Antibodies |
| Documents & Links for Anti CD86 pAb (ATL-HPA026802) | |
| Datasheet | Anti CD86 pAb (ATL-HPA026802) Datasheet (External Link) |
| Vendor Page | Anti CD86 pAb (ATL-HPA026802) |