Anti CD86 pAb (ATL-HPA026802)

Atlas Antibodies

Catalog No.:
ATL-HPA026802-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: CD86 molecule
Gene Name: CD86
Alternative Gene Name: B7-2, B7.2, CD28LG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022185: 42%, ENSRNOG00000013533: 42%
Entrez Gene ID: 942
Uniprot ID: P42081
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTNTMEREESEQTKKREKIHIPERSDEAQRV
Gene Sequence GTNTMEREESEQTKKREKIHIPERSDEAQRV
Gene ID - Mouse ENSMUSG00000022185
Gene ID - Rat ENSRNOG00000013533
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CD86 pAb (ATL-HPA026802)
Datasheet Anti CD86 pAb (ATL-HPA026802) Datasheet (External Link)
Vendor Page Anti CD86 pAb (ATL-HPA026802) at Atlas Antibodies

Documents & Links for Anti CD86 pAb (ATL-HPA026802)
Datasheet Anti CD86 pAb (ATL-HPA026802) Datasheet (External Link)
Vendor Page Anti CD86 pAb (ATL-HPA026802)