Anti CD81 pAb (ATL-HPA007234 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007234-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: CD81
Alternative Gene Name: TAPA-1, TAPA1, TSPAN28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037706: 81%, ENSRNOG00000020451: 85%
Entrez Gene ID: 975
Uniprot ID: P60033
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYL |
| Gene Sequence | VNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYL |
| Gene ID - Mouse | ENSMUSG00000037706 |
| Gene ID - Rat | ENSRNOG00000020451 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CD81 pAb (ATL-HPA007234 w/enhanced validation) | |
| Datasheet | Anti CD81 pAb (ATL-HPA007234 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD81 pAb (ATL-HPA007234 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CD81 pAb (ATL-HPA007234 w/enhanced validation) | |
| Datasheet | Anti CD81 pAb (ATL-HPA007234 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD81 pAb (ATL-HPA007234 w/enhanced validation) |
| Citations for Anti CD81 pAb (ATL-HPA007234 w/enhanced validation) – 4 Found |
| Zahoor, Muhammad; Westhrin, Marita; Aass, Kristin Roseth; Moen, Siv Helen; Misund, Kristine; Psonka-Antonczyk, Katarzyna Maria; Giliberto, Mariaserena; Buene, Glenn; Sundan, Anders; Waage, Anders; Sponaas, Anne-Marit; Standal, Therese. Hypoxia promotes IL-32 expression in myeloma cells, and high expression is associated with poor survival and bone loss. Blood Advances. 2017;1(27):2656-2666. PubMed |
| Langlois, Anne-Claire; Marinach, Carine; Manzoni, Giulia; Silvie, Olivier. Plasmodium sporozoites can invade hepatocytic cells independently of the Ephrin receptor A2. Plos One. 13(7):e0200032. PubMed |
| Ramanathan, Sujay; Shenoda, Botros B; Lin, Zhucheng; Alexander, Guillermo M; Huppert, Arthur; Sacan, Ahmet; Ajit, Seena K. Inflammation potentiates miR-939 expression and packaging into small extracellular vesicles. Journal Of Extracellular Vesicles. 8(1):1650595. PubMed |
| Ramos, Erika K; Tsai, Chia-Feng; Jia, Yuzhi; Cao, Yue; Manu, Megan; Taftaf, Rokana; Hoffmann, Andrew D; El-Shennawy, Lamiaa; Gritsenko, Marina A; Adorno-Cruz, Valery; Schuster, Emma J; Scholten, David; Patel, Dhwani; Liu, Xia; Patel, Priyam; Wray, Brian; Zhang, Youbin; Zhang, Shanshan; Moore, Ronald J; Mathews, Jeremy V; Schipma, Matthew J; Liu, Tao; Tokars, Valerie L; Cristofanilli, Massimo; Shi, Tujin; Shen, Yang; Dashzeveg, Nurmaa K; Liu, Huiping. Machine learning-assisted elucidation of CD81-CD44 interactions in promoting cancer stemness and extracellular vesicle integrity. Elife. 2022;11( 36193887) PubMed |