Anti CD81 pAb (ATL-HPA007234 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA007234-25

• 
• 

Protein Description: CD81 molecule
Gene Name: CD81
Alternative Gene Name: TAPA-1, TAPA1, TSPAN28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037706: 81%, ENSRNOG00000020451: 85%
Entrez Gene ID: 975
Uniprot ID: P60033
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYL
• Gene Sequence: VNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYL
• Gene ID - Mouse: ENSMUSG00000037706
• Gene ID - Rat: ENSRNOG00000020451
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CD81 pAb (ATL-HPA007234 w/enhanced validation) – 4 Found

Zahoor, Muhammad; Westhrin, Marita; Aass, Kristin Roseth; Moen, Siv Helen; Misund, Kristine; Psonka-Antonczyk, Katarzyna Maria; Giliberto, Mariaserena; Buene, Glenn; Sundan, Anders; Waage, Anders; Sponaas, Anne-Marit; Standal, Therese. Hypoxia promotes IL-32 expression in myeloma cells, and high expression is associated with poor survival and bone loss. Blood Advances. 2017;1(27):2656-2666. 

Langlois, Anne-Claire; Marinach, Carine; Manzoni, Giulia; Silvie, Olivier. Plasmodium sporozoites can invade hepatocytic cells independently of the Ephrin receptor A2. Plos One. 13(7):e0200032. 

Ramanathan, Sujay; Shenoda, Botros B; Lin, Zhucheng; Alexander, Guillermo M; Huppert, Arthur; Sacan, Ahmet; Ajit, Seena K. Inflammation potentiates miR-939 expression and packaging into small extracellular vesicles. Journal Of Extracellular Vesicles. 8(1):1650595. 

Ramos, Erika K; Tsai, Chia-Feng; Jia, Yuzhi; Cao, Yue; Manu, Megan; Taftaf, Rokana; Hoffmann, Andrew D; El-Shennawy, Lamiaa; Gritsenko, Marina A; Adorno-Cruz, Valery; Schuster, Emma J; Scholten, David; Patel, Dhwani; Liu, Xia; Patel, Priyam; Wray, Brian; Zhang, Youbin; Zhang, Shanshan; Moore, Ronald J; Mathews, Jeremy V; Schipma, Matthew J; Liu, Tao; Tokars, Valerie L; Cristofanilli, Massimo; Shi, Tujin; Shen, Yang; Dashzeveg, Nurmaa K; Liu, Huiping. Machine learning-assisted elucidation of CD81-CD44 interactions in promoting cancer stemness and extracellular vesicle integrity. Elife. 2022;11( 36193887)