Anti CD74 pAb (ATL-HPA010592)
Atlas Antibodies
- SKU:
- ATL-HPA010592-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: CD74
Alternative Gene Name: DHLAG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024610: 66%, ENSRNOG00000018735: 68%
Entrez Gene ID: 972
Uniprot ID: P04233
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPK |
Gene Sequence | PKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPK |
Gene ID - Mouse | ENSMUSG00000024610 |
Gene ID - Rat | ENSRNOG00000018735 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CD74 pAb (ATL-HPA010592) | |
Datasheet | Anti CD74 pAb (ATL-HPA010592) Datasheet (External Link) |
Vendor Page | Anti CD74 pAb (ATL-HPA010592) at Atlas Antibodies |
Documents & Links for Anti CD74 pAb (ATL-HPA010592) | |
Datasheet | Anti CD74 pAb (ATL-HPA010592) Datasheet (External Link) |
Vendor Page | Anti CD74 pAb (ATL-HPA010592) |
Citations for Anti CD74 pAb (ATL-HPA010592) – 8 Found |
Colin, Didier J; Cottet-Dumoulin, David; Faivre, Anna; Germain, Stéphane; Triponez, Frédéric; Serre-Beinier, Véronique. Experimental Model of Human Malignant Mesothelioma in Athymic Mice. International Journal Of Molecular Sciences. 2018;19(7) PubMed |
Balakrishnan, Carol K; Tye, Gee Jun; Balasubramaniam, Shandra Devi; Kaur, Gurjeet. CD74 and HLA-DRA in Cervical Carcinogenesis: Potential Targets for Antitumour Therapy. Medicina (Kaunas, Lithuania). 2022;58(2) PubMed |
Adamek, Dariusz; Radwańska, Edyta; Gajda, Mariusz. Expression of RCAS1 protein in microglia/macrophages accompanying brain tumours. An immunofluorescence study. Folia Neuropathologica. 47(3):240-6. PubMed |
Otterstrom, C; Soltermann, A; Opitz, I; Felley-Bosco, E; Weder, W; Stahel, R A; Triponez, F; Robert, J H; Serre-Beinier, V. CD74: a new prognostic factor for patients with malignant pleural mesothelioma. British Journal Of Cancer. 2014;110(8):2040-6. PubMed |
Cameron, S A; White, S M; Arrollo, D; Shulman, S T; Rowley, A H. Arterial immune protein expression demonstrates the complexity of immune responses in Kawasaki disease arteritis. Clinical And Experimental Immunology. 2017;190(2):244-250. PubMed |
Olah, Marta; Menon, Vilas; Habib, Naomi; Taga, Mariko F; Ma, Yiyi; Yung, Christina J; Cimpean, Maria; Khairallah, Anthony; Coronas-Samano, Guillermo; Sankowski, Roman; Grün, Dominic; Kroshilina, Alexandra A; Dionne, Danielle; Sarkis, Rani A; Cosgrove, Garth R; Helgager, Jeffrey; Golden, Jeffrey A; Pennell, Page B; Prinz, Marco; Vonsattel, Jean Paul G; Teich, Andrew F; Schneider, Julie A; Bennett, David A; Regev, Aviv; Elyaman, Wassim; Bradshaw, Elizabeth M; De Jager, Philip L. Single cell RNA sequencing of human microglia uncovers a subset associated with Alzheimer's disease. Nature Communications. 2020;11(1):6129. PubMed |
Klemke, Luisa; De Oliveira, Tiago; Witt, Daria; Winkler, Nadine; Bohnenberger, Hanibal; Bucala, Richard; Conradi, Lena-Christin; Schulz-Heddergott, Ramona. Hsp90-stabilized MIF supports tumor progression via macrophage recruitment and angiogenesis in colorectal cancer. Cell Death & Disease. 2021;12(2):155. PubMed |
Kershner, Leah J; Choi, Kwangmin; Wu, Jianqiang; Zhang, Xiyuan; Perrino, Melissa; Salomonis, Nathan; Shern, Jack F; Ratner, Nancy. Multiple Nf1 Schwann cell populations reprogram the plexiform neurofibroma tumor microenvironment. Jci Insight. 2022;7(18) PubMed |