Anti CD7 pAb (ATL-HPA039079 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA039079-25
  • Immunohistochemistry analysis in human spleen and cerebral cortex tissues using Anti-CD7 antibody. Corresponding CD7 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: CD7 molecule
Gene Name: CD7
Alternative Gene Name: GP40, LEU-9, Tp40, TP41
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040289: 33%, ENSRNOG00000031368: 32%
Entrez Gene ID: 924
Uniprot ID: P09564
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAAS
Gene Sequence YTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAAS
Gene ID - Mouse ENSMUSG00000040289
Gene ID - Rat ENSRNOG00000031368
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CD7 pAb (ATL-HPA039079 w/enhanced validation)
Datasheet Anti CD7 pAb (ATL-HPA039079 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD7 pAb (ATL-HPA039079 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CD7 pAb (ATL-HPA039079 w/enhanced validation)
Datasheet Anti CD7 pAb (ATL-HPA039079 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD7 pAb (ATL-HPA039079 w/enhanced validation)