Anti CD69 pAb (ATL-HPA050525 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050525-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CD69
Alternative Gene Name: CLEC2C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030156: 58%, ENSRNOG00000056783: 55%
Entrez Gene ID: 969
Uniprot ID: Q07108
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSE |
Gene Sequence | VGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSE |
Gene ID - Mouse | ENSMUSG00000030156 |
Gene ID - Rat | ENSRNOG00000056783 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CD69 pAb (ATL-HPA050525 w/enhanced validation) | |
Datasheet | Anti CD69 pAb (ATL-HPA050525 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CD69 pAb (ATL-HPA050525 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CD69 pAb (ATL-HPA050525 w/enhanced validation) | |
Datasheet | Anti CD69 pAb (ATL-HPA050525 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CD69 pAb (ATL-HPA050525 w/enhanced validation) |
Citations for Anti CD69 pAb (ATL-HPA050525 w/enhanced validation) – 2 Found |
Chang, Margaret H; Levescot, Anaïs; Nelson-Maney, Nathan; Blaustein, Rachel B; Winden, Kellen D; Morris, Allyn; Wactor, Alexandra; Balu, Spoorthi; Grieshaber-Bouyer, Ricardo; Wei, Kevin; Henderson, Lauren A; Iwakura, Yoichiro; Clark, Rachael A; Rao, Deepak A; Fuhlbrigge, Robert C; Nigrovic, Peter A. Arthritis flares mediated by tissue-resident memory T cells in the joint. Cell Reports. 2021;37(4):109902. PubMed |
Griss, Johannes; Bauer, Wolfgang; Wagner, Christine; Simon, Martin; Chen, Minyi; Grabmeier-Pfistershammer, Katharina; Maurer-Granofszky, Margarita; Roka, Florian; Penz, Thomas; Bock, Christoph; Zhang, Gao; Herlyn, Meenhard; Glatz, Katharina; Läubli, Heinz; Mertz, Kirsten D; Petzelbauer, Peter; Wiesner, Thomas; Hartl, Markus; Pickl, Winfried F; Somasundaram, Rajasekharan; Steinberger, Peter; Wagner, Stephan N. B cells sustain inflammation and predict response to immune checkpoint blockade in human melanoma. Nature Communications. 2019;10(1):4186. PubMed |