Anti CD63 pAb (ATL-HPA010088)
Atlas Antibodies
- Catalog No.:
- ATL-HPA010088-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: CD63
Alternative Gene Name: ME491, MLA1, TSPAN30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025351: 65%, ENSRNOG00000007650: 63%
Entrez Gene ID: 967
Uniprot ID: P08962
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIG |
| Gene Sequence | RDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIG |
| Gene ID - Mouse | ENSMUSG00000025351 |
| Gene ID - Rat | ENSRNOG00000007650 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CD63 pAb (ATL-HPA010088) | |
| Datasheet | Anti CD63 pAb (ATL-HPA010088) Datasheet (External Link) |
| Vendor Page | Anti CD63 pAb (ATL-HPA010088) at Atlas Antibodies |
| Documents & Links for Anti CD63 pAb (ATL-HPA010088) | |
| Datasheet | Anti CD63 pAb (ATL-HPA010088) Datasheet (External Link) |
| Vendor Page | Anti CD63 pAb (ATL-HPA010088) |
| Citations for Anti CD63 pAb (ATL-HPA010088) – 8 Found |
| Wei, Xiaojuan; Liu, Chaozhong; Wang, Hengxiang; Wang, Lisheng; Xiao, Fengjun; Guo, Zikuan; Zhang, Hongchao. Surface Phosphatidylserine Is Responsible for the Internalization on Microvesicles Derived from Hypoxia-Induced Human Bone Marrow Mesenchymal Stem Cells into Human Endothelial Cells. Plos One. 11(1):e0147360. PubMed |
| Pinet, Sandra; Bessette, Barbara; Vedrenne, Nicolas; Lacroix, Aurélie; Richard, Laurence; Jauberteau, Marie-Odile; Battu, Serge; Lalloué, Fabrice. TrkB-containing exosomes promote the transfer of glioblastoma aggressiveness to YKL-40-inactivated glioblastoma cells. Oncotarget. 2016;7(31):50349-50364. PubMed |
| Shields, Bradley D; Mahmoud, Fade; Taylor, Erin M; Byrum, Stephanie D; Sengupta, Deepanwita; Koss, Brian; Baldini, Giulia; Ransom, Seth; Cline, Kyle; Mackintosh, Samuel G; Edmondson, Ricky D; Shalin, Sara; Tackett, Alan J. Indicators of responsiveness to immune checkpoint inhibitors. Scientific Reports. 2017;7(1):807. PubMed |
| Zahoor, Muhammad; Westhrin, Marita; Aass, Kristin Roseth; Moen, Siv Helen; Misund, Kristine; Psonka-Antonczyk, Katarzyna Maria; Giliberto, Mariaserena; Buene, Glenn; Sundan, Anders; Waage, Anders; Sponaas, Anne-Marit; Standal, Therese. Hypoxia promotes IL-32 expression in myeloma cells, and high expression is associated with poor survival and bone loss. Blood Advances. 2017;1(27):2656-2666. PubMed |
| Aaberg-Jessen, Charlotte; Sørensen, Mia D; Matos, Ana L S A; Moreira, José M; Brünner, Nils; Knudsen, Arnon; Kristensen, Bjarne W. Co-expression of TIMP-1 and its cell surface binding partner CD63 in glioblastomas. Bmc Cancer. 2018;18(1):270. PubMed |
| Shu, Shin La; Yang, Yunchen; Allen, Cheryl L; Maguire, Orla; Minderman, Hans; Sen, Arindam; Ciesielski, Michael J; Collins, Katherine A; Bush, Peter J; Singh, Prashant; Wang, Xue; Morgan, Martin; Qu, Jun; Bankert, Richard B; Whiteside, Theresa L; Wu, Yun; Ernstoff, Marc S. Metabolic reprogramming of stromal fibroblasts by melanoma exosome microRNA favours a pre-metastatic microenvironment. Scientific Reports. 2018;8(1):12905. PubMed |
| Kishikawa, Takahiro; Otsuka, Motoyuki; Yoshikawa, Takeshi; Ohno, Motoko; Yamamoto, Keisuke; Yamamoto, Natsuyo; Kotani, Ai; Koike, Kazuhiko. Quantitation of circulating satellite RNAs in pancreatic cancer patients. Jci Insight. 2016;1(8):e86646. PubMed |
| Shu, Shin La; Yang, Yunchen; Allen, Cheryl L; Hurley, Edward; Tung, Kaity H; Minderman, Hans; Wu, Yun; Ernstoff, Marc S. Purity and yield of melanoma exosomes are dependent on isolation method. Journal Of Extracellular Vesicles. 9(1):1692401. PubMed |