Anti CD5L pAb (ATL-HPA068384 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA068384-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CD5L
Alternative Gene Name: API6, Spalpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015854: 63%, ENSRNOG00000023068: 59%
Entrez Gene ID: 922
Uniprot ID: O43866
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LGCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDC |
| Gene Sequence | LGCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDC |
| Gene ID - Mouse | ENSMUSG00000015854 |
| Gene ID - Rat | ENSRNOG00000023068 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CD5L pAb (ATL-HPA068384 w/enhanced validation) | |
| Datasheet | Anti CD5L pAb (ATL-HPA068384 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD5L pAb (ATL-HPA068384 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CD5L pAb (ATL-HPA068384 w/enhanced validation) | |
| Datasheet | Anti CD5L pAb (ATL-HPA068384 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD5L pAb (ATL-HPA068384 w/enhanced validation) |