Anti CD5L pAb (ATL-HPA068384 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA068384-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: CD5 molecule-like
Gene Name: CD5L
Alternative Gene Name: API6, Spalpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015854: 63%, ENSRNOG00000023068: 59%
Entrez Gene ID: 922
Uniprot ID: O43866
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDC
Gene Sequence LGCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDC
Gene ID - Mouse ENSMUSG00000015854
Gene ID - Rat ENSRNOG00000023068
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CD5L pAb (ATL-HPA068384 w/enhanced validation)
Datasheet Anti CD5L pAb (ATL-HPA068384 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD5L pAb (ATL-HPA068384 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CD5L pAb (ATL-HPA068384 w/enhanced validation)
Datasheet Anti CD5L pAb (ATL-HPA068384 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD5L pAb (ATL-HPA068384 w/enhanced validation)