Anti CD59 pAb (ATL-HPA026494 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026494-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: CD59
Alternative Gene Name: 16.3A5, EJ16, EJ30, EL32, G344, MIC11, MIN1, MIN2, MIN3, MSK21, p18-20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068686: 42%, ENSRNOG00000042821: 44%
Entrez Gene ID: 966
Uniprot ID: P13987
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGG |
| Gene Sequence | CYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGG |
| Gene ID - Mouse | ENSMUSG00000068686 |
| Gene ID - Rat | ENSRNOG00000042821 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CD59 pAb (ATL-HPA026494 w/enhanced validation) | |
| Datasheet | Anti CD59 pAb (ATL-HPA026494 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD59 pAb (ATL-HPA026494 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CD59 pAb (ATL-HPA026494 w/enhanced validation) | |
| Datasheet | Anti CD59 pAb (ATL-HPA026494 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD59 pAb (ATL-HPA026494 w/enhanced validation) |
| Citations for Anti CD59 pAb (ATL-HPA026494 w/enhanced validation) – 2 Found |
| Cheng, L; Gou, S-J; Qiu, H-Y; Ma, L; Fu, P. Complement regulatory proteins in kidneys of patients with anti-neutrophil cytoplasmic antibody (ANCA)-associated vasculitis. Clinical And Experimental Immunology. 2018;191(1):116-124. PubMed |
| Zhang, Ronghua; Liu, Qiaofei; Peng, Junya; Wang, Mengyi; Gao, Xiang; Liao, Quan; Zhao, Yupei. Pancreatic cancer-educated macrophages protect cancer cells from complement-dependent cytotoxicity by up-regulation of CD59. Cell Death & Disease. 2019;10(11):836. PubMed |