Anti CD59 pAb (ATL-HPA026494 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA026494-25

Protein Description: CD59 molecule, complement regulatory protein
Gene Name: CD59
Alternative Gene Name: 16.3A5, EJ16, EJ30, EL32, G344, MIC11, MIN1, MIN2, MIN3, MSK21, p18-20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068686: 42%, ENSRNOG00000042821: 44%
Entrez Gene ID: 966
Uniprot ID: P13987
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGG
• Gene Sequence: CYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGG
• Gene ID - Mouse: ENSMUSG00000068686
• Gene ID - Rat: ENSRNOG00000042821
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CD59 pAb (ATL-HPA026494 w/enhanced validation) – 2 Found

Cheng, L; Gou, S-J; Qiu, H-Y; Ma, L; Fu, P. Complement regulatory proteins in kidneys of patients with anti-neutrophil cytoplasmic antibody (ANCA)-associated vasculitis. Clinical And Experimental Immunology. 2018;191(1):116-124. 

Zhang, Ronghua; Liu, Qiaofei; Peng, Junya; Wang, Mengyi; Gao, Xiang; Liao, Quan; Zhao, Yupei. Pancreatic cancer-educated macrophages protect cancer cells from complement-dependent cytotoxicity by up-regulation of CD59. Cell Death & Disease. 2019;10(11):836.