Anti CD53 pAb (ATL-HPA047216)

Atlas Antibodies

Catalog No.:
ATL-HPA047216-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: CD53 molecule
Gene Name: CD53
Alternative Gene Name: MOX44, TSPAN25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040747: 70%, ENSRNOG00000017874: 69%
Entrez Gene ID: 963
Uniprot ID: P19397
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHS
Gene Sequence NEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHS
Gene ID - Mouse ENSMUSG00000040747
Gene ID - Rat ENSRNOG00000017874
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CD53 pAb (ATL-HPA047216)
Datasheet Anti CD53 pAb (ATL-HPA047216) Datasheet (External Link)
Vendor Page Anti CD53 pAb (ATL-HPA047216) at Atlas Antibodies

Documents & Links for Anti CD53 pAb (ATL-HPA047216)
Datasheet Anti CD53 pAb (ATL-HPA047216) Datasheet (External Link)
Vendor Page Anti CD53 pAb (ATL-HPA047216)