Anti CD48 pAb (ATL-HPA055146)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055146-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CD48
Alternative Gene Name: BCM1, BLAST, hCD48, mCD48, SLAMF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015355: 54%, ENSRNOG00000004737: 48%
Entrez Gene ID: 962
Uniprot ID: P09326
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESV |
Gene Sequence | VQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESV |
Gene ID - Mouse | ENSMUSG00000015355 |
Gene ID - Rat | ENSRNOG00000004737 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CD48 pAb (ATL-HPA055146) | |
Datasheet | Anti CD48 pAb (ATL-HPA055146) Datasheet (External Link) |
Vendor Page | Anti CD48 pAb (ATL-HPA055146) at Atlas Antibodies |
Documents & Links for Anti CD48 pAb (ATL-HPA055146) | |
Datasheet | Anti CD48 pAb (ATL-HPA055146) Datasheet (External Link) |
Vendor Page | Anti CD48 pAb (ATL-HPA055146) |