Anti CD47 pAb (ATL-HPA044659)

Atlas Antibodies

Catalog No.:
ATL-HPA044659-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: CD47 molecule
Gene Name: CD47
Alternative Gene Name: IAP, MER6, OA3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055447: 59%, ENSRNOG00000001964: 64%
Entrez Gene ID: 961
Uniprot ID: Q08722
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVS
Gene Sequence AQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVS
Gene ID - Mouse ENSMUSG00000055447
Gene ID - Rat ENSRNOG00000001964
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CD47 pAb (ATL-HPA044659)
Datasheet Anti CD47 pAb (ATL-HPA044659) Datasheet (External Link)
Vendor Page Anti CD47 pAb (ATL-HPA044659) at Atlas Antibodies

Documents & Links for Anti CD47 pAb (ATL-HPA044659)
Datasheet Anti CD47 pAb (ATL-HPA044659) Datasheet (External Link)
Vendor Page Anti CD47 pAb (ATL-HPA044659)
Citations for Anti CD47 pAb (ATL-HPA044659) – 5 Found
Honkanen, Tiia J; Tikkanen, Antti; Karihtala, Peeter; Mäkinen, Markus; Väyrynen, Juha P; Koivunen, Jussi P. Prognostic and predictive role of tumour-associated macrophages in HER2 positive breast cancer. Scientific Reports. 2019;9(1):10961.  PubMed
Hsieh, Lance Y; Chiang, Austin W T; Duong, Loan D; Kuo, Chih-Chung; Dong, Stephanie X; Dohil, Ranjan; Kurten, Richard; Lewis, Nathan E; Aceves, Seema S. A unique esophageal extracellular matrix proteome alters normal fibroblast function in severe eosinophilic esophagitis. The Journal Of Allergy And Clinical Immunology. 2021;148(2):486-494.  PubMed
Verver, Daniëlle; Poirier-Colame, Vichnou; Tomasic, Gorana; Cherif-Rebai, Khadija; Grunhagen, Dirk J; Verhoef, Cornelis; Suciu, Stefan; Robert, Caroline; Zitvogel, Laurence; Eggermont, Alexander M M. Upregulation of intratumoral HLA class I and peritumoral Mx1 in ulcerated melanomas. Oncoimmunology. 8(11):e1660121.  PubMed
Lang, C; Lantos, A; Megyesfalvi, Z; Egger, F; Hoda, M A; Mosleh, B; Klikovits, T; Oberndorfer, F; Timelthaler, G; Ferencz, B; Fillinger, J; Schwendenwein, A; Querner, A S; Boettiger, K; Renyi-Vamos, F; Hoetzenecker, K; Laszlo, V; Schelch, K; Dome, B. Clinical and prognostic implications of CD47 and PD-L1 expression in surgically resected small-cell lung cancer. Esmo Open. 2022;7(6):100631.  PubMed
Cho, Junhun; Yoon, Sang Eun; Kim, Seok Jin; Ko, Young Hyeh; Kim, Won Seog. CD47 overexpression is common in intestinal non-GCB type diffuse large B-cell lymphoma and associated with 18q21 gain. Blood Advances. 2022;6(24):6120-6130.  PubMed