Anti CD47 pAb (ATL-HPA044659)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044659-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CD47
Alternative Gene Name: IAP, MER6, OA3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055447: 59%, ENSRNOG00000001964: 64%
Entrez Gene ID: 961
Uniprot ID: Q08722
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVS |
| Gene Sequence | AQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVS |
| Gene ID - Mouse | ENSMUSG00000055447 |
| Gene ID - Rat | ENSRNOG00000001964 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CD47 pAb (ATL-HPA044659) | |
| Datasheet | Anti CD47 pAb (ATL-HPA044659) Datasheet (External Link) |
| Vendor Page | Anti CD47 pAb (ATL-HPA044659) at Atlas Antibodies |
| Documents & Links for Anti CD47 pAb (ATL-HPA044659) | |
| Datasheet | Anti CD47 pAb (ATL-HPA044659) Datasheet (External Link) |
| Vendor Page | Anti CD47 pAb (ATL-HPA044659) |
| Citations for Anti CD47 pAb (ATL-HPA044659) – 5 Found |
| Honkanen, Tiia J; Tikkanen, Antti; Karihtala, Peeter; Mäkinen, Markus; Väyrynen, Juha P; Koivunen, Jussi P. Prognostic and predictive role of tumour-associated macrophages in HER2 positive breast cancer. Scientific Reports. 2019;9(1):10961. PubMed |
| Hsieh, Lance Y; Chiang, Austin W T; Duong, Loan D; Kuo, Chih-Chung; Dong, Stephanie X; Dohil, Ranjan; Kurten, Richard; Lewis, Nathan E; Aceves, Seema S. A unique esophageal extracellular matrix proteome alters normal fibroblast function in severe eosinophilic esophagitis. The Journal Of Allergy And Clinical Immunology. 2021;148(2):486-494. PubMed |
| Verver, Daniëlle; Poirier-Colame, Vichnou; Tomasic, Gorana; Cherif-Rebai, Khadija; Grunhagen, Dirk J; Verhoef, Cornelis; Suciu, Stefan; Robert, Caroline; Zitvogel, Laurence; Eggermont, Alexander M M. Upregulation of intratumoral HLA class I and peritumoral Mx1 in ulcerated melanomas. Oncoimmunology. 8(11):e1660121. PubMed |
| Lang, C; Lantos, A; Megyesfalvi, Z; Egger, F; Hoda, M A; Mosleh, B; Klikovits, T; Oberndorfer, F; Timelthaler, G; Ferencz, B; Fillinger, J; Schwendenwein, A; Querner, A S; Boettiger, K; Renyi-Vamos, F; Hoetzenecker, K; Laszlo, V; Schelch, K; Dome, B. Clinical and prognostic implications of CD47 and PD-L1 expression in surgically resected small-cell lung cancer. Esmo Open. 2022;7(6):100631. PubMed |
| Cho, Junhun; Yoon, Sang Eun; Kim, Seok Jin; Ko, Young Hyeh; Kim, Won Seog. CD47 overexpression is common in intestinal non-GCB type diffuse large B-cell lymphoma and associated with 18q21 gain. Blood Advances. 2022;6(24):6120-6130. PubMed |