Anti CD40LG pAb (ATL-HPA072480 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA072480-25
  • Immunohistochemistry analysis in human lymph node and cerebral cortex tissues using Anti-CD40LG antibody. Corresponding CD40LG RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: CD40 ligand
Gene Name: CD40LG
Alternative Gene Name: CD154, CD40L, gp39, hCD40L, HIGM1, IMD3, TNFSF5, TRAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031132: 76%, ENSRNOG00000000871: 74%
Entrez Gene ID: 959
Uniprot ID: P29965
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQL
Gene Sequence EMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQL
Gene ID - Mouse ENSMUSG00000031132
Gene ID - Rat ENSRNOG00000000871
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CD40LG pAb (ATL-HPA072480 w/enhanced validation)
Datasheet Anti CD40LG pAb (ATL-HPA072480 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD40LG pAb (ATL-HPA072480 w/enhanced validation)