Anti CD40 pAb (ATL-HPA031567 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA031567-25
  • Immunohistochemistry analysis in human tonsil and cerebral cortex tissues using HPA031567 antibody. Corresponding CD40 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: CD40 molecule, TNF receptor superfamily member 5
Gene Name: CD40
Alternative Gene Name: Bp50, p50, TNFRSF5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017652: 58%, ENSRNOG00000018488: 54%
Entrez Gene ID: 958
Uniprot ID: P25942
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCE
Gene Sequence KQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCE
Gene ID - Mouse ENSMUSG00000017652
Gene ID - Rat ENSRNOG00000018488
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CD40 pAb (ATL-HPA031567 w/enhanced validation)
Datasheet Anti CD40 pAb (ATL-HPA031567 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD40 pAb (ATL-HPA031567 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CD40 pAb (ATL-HPA031567 w/enhanced validation)
Datasheet Anti CD40 pAb (ATL-HPA031567 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD40 pAb (ATL-HPA031567 w/enhanced validation)