Anti CD3G pAb (ATL-HPA038494 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA038494-25

• 
• 

Protein Description: CD3g molecule, gamma (CD3-TCR complex)
Gene Name: CD3G
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002033: 89%, ENSRNOG00000015945: 80%
Entrez Gene ID: 917
Uniprot ID: P09693
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN
• Gene Sequence: GQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN
• Gene ID - Mouse: ENSMUSG00000002033
• Gene ID - Rat: ENSRNOG00000015945
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.