Anti CD3G pAb (ATL-HPA038494 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038494-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CD3G
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002033: 89%, ENSRNOG00000015945: 80%
Entrez Gene ID: 917
Uniprot ID: P09693
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN |
Gene Sequence | GQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN |
Gene ID - Mouse | ENSMUSG00000002033 |
Gene ID - Rat | ENSRNOG00000015945 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CD3G pAb (ATL-HPA038494 w/enhanced validation) | |
Datasheet | Anti CD3G pAb (ATL-HPA038494 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CD3G pAb (ATL-HPA038494 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CD3G pAb (ATL-HPA038494 w/enhanced validation) | |
Datasheet | Anti CD3G pAb (ATL-HPA038494 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CD3G pAb (ATL-HPA038494 w/enhanced validation) |