Anti CD3G pAb (ATL-HPA038494 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA038494-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: CD3g molecule, gamma (CD3-TCR complex)
Gene Name: CD3G
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002033: 89%, ENSRNOG00000015945: 80%
Entrez Gene ID: 917
Uniprot ID: P09693
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN
Gene Sequence GQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN
Gene ID - Mouse ENSMUSG00000002033
Gene ID - Rat ENSRNOG00000015945
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CD3G pAb (ATL-HPA038494 w/enhanced validation)
Datasheet Anti CD3G pAb (ATL-HPA038494 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD3G pAb (ATL-HPA038494 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CD3G pAb (ATL-HPA038494 w/enhanced validation)
Datasheet Anti CD3G pAb (ATL-HPA038494 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD3G pAb (ATL-HPA038494 w/enhanced validation)