Anti CD3EAP pAb (ATL-HPA041734 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA041734-25
  • Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus, nucleoli fibrillar center & mitochondria.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and CD3EAP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY415980).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: CD3e molecule, epsilon associated protein
Gene Name: CD3EAP
Alternative Gene Name: ASE-1, CAST, PAF49
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047649: 44%, ENSRNOG00000016825: 47%
Entrez Gene ID: 10849
Uniprot ID: O15446
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GNPPVTGPRSALAPNLLTSGKKKKEMQVTEAPVTQEAVNGHGALEVDMALGSPEMDVRKKKKKKNQQLKEPEAAGPVGTEPTVETLEPLGVLFPSTTKKRKKPKGK
Gene Sequence GNPPVTGPRSALAPNLLTSGKKKKEMQVTEAPVTQEAVNGHGALEVDMALGSPEMDVRKKKKKKNQQLKEPEAAGPVGTEPTVETLEPLGVLFPSTTKKRKKPKGK
Gene ID - Mouse ENSMUSG00000047649
Gene ID - Rat ENSRNOG00000016825
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CD3EAP pAb (ATL-HPA041734 w/enhanced validation)
Datasheet Anti CD3EAP pAb (ATL-HPA041734 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD3EAP pAb (ATL-HPA041734 w/enhanced validation)