Anti CD3E pAb (ATL-HPA043955 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA043955-25

• 
• 

Protein Description: CD3e molecule, epsilon (CD3-TCR complex)
Gene Name: CD3E
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032093: 91%, ENSRNOG00000016069: 89%
Entrez Gene ID: 916
Uniprot ID: P07766
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
• Gene Sequence: WSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
• Gene ID - Mouse: ENSMUSG00000032093
• Gene ID - Rat: ENSRNOG00000016069
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.