Anti CD3E pAb (ATL-HPA040957 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA040957-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: CD3e molecule, epsilon (CD3-TCR complex)
Gene Name: CD3E
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032093: 43%, ENSRNOG00000016069: 50%
Entrez Gene ID: 916
Uniprot ID: P07766
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
Gene Sequence NEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
Gene ID - Mouse ENSMUSG00000032093
Gene ID - Rat ENSRNOG00000016069
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CD3E pAb (ATL-HPA040957 w/enhanced validation)
Datasheet Anti CD3E pAb (ATL-HPA040957 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD3E pAb (ATL-HPA040957 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CD3E pAb (ATL-HPA040957 w/enhanced validation)
Datasheet Anti CD3E pAb (ATL-HPA040957 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD3E pAb (ATL-HPA040957 w/enhanced validation)