Anti CD38 pAb (ATL-HPA022132 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA022132-25
  • Immunohistochemistry analysis in human tonsil and kidney tissues using HPA022132 antibody. Corresponding CD38 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line A549 shows localization to plasma membrane.
  • Western blot analysis in human cell line Daudi.
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: CD38 molecule
Gene Name: CD38
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029084: 53%, ENSRNOG00000003069: 57%
Entrez Gene ID: 952
Uniprot ID: P28907
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AACDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEI
Gene Sequence AACDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEI
Gene ID - Mouse ENSMUSG00000029084
Gene ID - Rat ENSRNOG00000003069
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CD38 pAb (ATL-HPA022132 w/enhanced validation)
Datasheet Anti CD38 pAb (ATL-HPA022132 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD38 pAb (ATL-HPA022132 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CD38 pAb (ATL-HPA022132 w/enhanced validation)
Datasheet Anti CD38 pAb (ATL-HPA022132 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD38 pAb (ATL-HPA022132 w/enhanced validation)



Citations for Anti CD38 pAb (ATL-HPA022132 w/enhanced validation) – 3 Found
Dawicki, Wojciech; Allen, Kevin J H; Jiao, Rubin; Malo, Mackenzie E; Helal, Muath; Berger, Mark S; Ludwig, Dale L; Dadachova, Ekaterina. Daratumumab-(225)Actinium conjugate demonstrates greatly enhanced antitumor activity against experimental multiple myeloma tumors. Oncoimmunology. 8(8):1607673.  PubMed
Costa, Federica; Toscani, Denise; Chillemi, Antonella; Quarona, Valeria; Bolzoni, Marina; Marchica, Valentina; Vescovini, Rosanna; Mancini, Cristina; Martella, Eugenia; Campanini, Nicoletta; Schifano, Chiara; Bonomini, Sabrina; Accardi, Fabrizio; Horenstein, Alberto L; Aversa, Franco; Malavasi, Fabio; Giuliani, Nicola. Expression of CD38 in myeloma bone niche: A rational basis for the use of anti-CD38 immunotherapy to inhibit osteoclast formation. Oncotarget. 2017;8(34):56598-56611.  PubMed
Bar, Isabelle; Theate, Ivan; Haussy, Sandy; Beniuga, Gabriela; Carrasco, Javier; Canon, Jean-Luc; Delrée, Paul; Merhi, Ahmad. MiR-210 Is Overexpressed in Tumor-infiltrating Plasma Cells in Triple-negative Breast Cancer. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2020;68(1):25-32.  PubMed