Anti CD37 pAb (ATL-HPA032121 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA032121-25
  • Immunohistochemistry analysis in human tonsil and skeletal muscle tissues using HPA032121 antibody. Corresponding CD37 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: CD37 molecule
Gene Name: CD37
Alternative Gene Name: TSPAN26
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030798: 63%, ENSRNOG00000020699: 64%
Entrez Gene ID: 951
Uniprot ID: P11049
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ISTQRAQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEA
Gene Sequence ISTQRAQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEA
Gene ID - Mouse ENSMUSG00000030798
Gene ID - Rat ENSRNOG00000020699
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CD37 pAb (ATL-HPA032121 w/enhanced validation)
Datasheet Anti CD37 pAb (ATL-HPA032121 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD37 pAb (ATL-HPA032121 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CD37 pAb (ATL-HPA032121 w/enhanced validation)
Datasheet Anti CD37 pAb (ATL-HPA032121 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD37 pAb (ATL-HPA032121 w/enhanced validation)