Anti CD36 pAb (ATL-HPA002018 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA002018-25

Protein Description: CD36 molecule (thrombospondin receptor)
Gene Name: CD36
Alternative Gene Name: FAT, GP3B, GP4, GPIV, SCARB3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002944: 84%, ENSRNOG00000040108: 84%
Entrez Gene ID: 948
Uniprot ID: P16671
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLREL
• Gene Sequence: VVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLREL
• Gene ID - Mouse: ENSMUSG00000002944
• Gene ID - Rat: ENSRNOG00000040108
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CD36 pAb (ATL-HPA002018 w/enhanced validation) – 5 Found

Ladanyi, Andras; Mukherjee, Abir; Kenny, Hilary A; Johnson, Alyssa; Mitra, Anirban K; Sundaresan, Sinju; Nieman, Kristin M; Pascual, Gloria; Benitah, Salvador Aznar; Montag, Anthony; Yamada, S Diane; Abumrad, Nada A; Lengyel, Ernst. Adipocyte-induced CD36 expression drives ovarian cancer progression and metastasis. Oncogene. 2018;37(17):2285-2301. 

Vendramin, Roberto; Katopodi, Vicky; Cinque, Sonia; Konnova, Angelina; Knezevic, Zorica; Adnane, Sara; Verheyden, Yvessa; Karras, Panagiotis; Demesmaeker, Ewout; Bosisio, Francesca M; Kucera, Lukas; Rozman, Jan; Gladwyn-Ng, Ivan; Rizzotto, Lara; Dassi, Erik; Millevoi, Stefania; Bechter, Oliver; Marine, Jean-Christophe; Leucci, Eleonora. Activation of the integrated stress response confers vulnerability to mitoribosome-targeting antibiotics in melanoma. The Journal Of Experimental Medicine. 2021;218(9) 

Giannoni, Paolo; Narcisi, Roberto; De Totero, Daniela; Romussi, Giovanni; Quarto, Rodolfo; Bisio, Angela. The administration of demethyl fruticulin A from Salvia corrugata to mammalian cells lines induces "anoikis", a special form of apoptosis. Phytomedicine : International Journal Of Phytotherapy And Phytopharmacology. 2010;17(6):449-56. 

Thomas, Melissa M; Trajcevski, Karin E; Coleman, Samantha K; Jiang, Maggie; Di Michele, Joseph; O'Neill, Hayley M; Lally, James S; Steinberg, Gregory R; Hawke, Thomas J. Early oxidative shifts in mouse skeletal muscle morphology with high-fat diet consumption do not lead to functional improvements. Physiological Reports. 2014;2(9) 

Marino, Natascia; German, Rana; Rao, Xi; Simpson, Ed; Liu, Sheng; Wan, Jun; Liu, Yunlong; Sandusky, George; Jacobsen, Max; Stoval, Miranda; Cao, Sha; Storniolo, Anna Maria V. Upregulation of lipid metabolism genes in the breast prior to cancer diagnosis. Npj Breast Cancer. 6( 33083529):50.