Anti CD34 pAb (ATL-HPA036723 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA036723-25

• 
• 

Protein Description: CD34 molecule
Gene Name: CD34
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016494: 95%, ENSRNOG00000045558: 96%
Entrez Gene ID: 947
Uniprot ID: P28906
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL
• Gene Sequence: LMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL
• Gene ID - Mouse: ENSMUSG00000016494
• Gene ID - Rat: ENSRNOG00000045558
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CD34 pAb (ATL-HPA036723 w/enhanced validation) – 3 Found

Spiegler, Stefanie; Rath, Matthias; Much, Christiane D; Sendtner, Barbara S; Felbor, Ute. Precise CCM1 gene correction and inactivation in patient-derived endothelial cells: Modeling Knudson's two-hit hypothesis in vitro. Molecular Genetics & Genomic Medicine. 2019;7(7):e00755. 

Pan, Li; Lemieux, Madeleine E; Thomas, Tom; Rogers, Julia M; Lipper, Colin H; Lee, Winston; Johnson, Carl; Sholl, Lynette M; South, Andrew P; Marto, Jarrod A; Adelmant, Guillaume O; Blacklow, Stephen C; Aster, Jon C. IER5, a DNA damage response gene, is required for Notch-mediated induction of squamous cell differentiation. Elife. 2020;9( 32936072) 

Taher, Husam; Mahyari, Eisa; Kreklywich, Craig; Uebelhoer, Luke S; McArdle, Matthew R; Moström, Matilda J; Bhusari, Amruta; Nekorchuk, Michael; E, Xiaofei; Whitmer, Travis; Scheef, Elizabeth A; Sprehe, Lesli M; Roberts, Dawn L; Hughes, Colette M; Jackson, Kerianne A; Selseth, Andrea N; Ventura, Abigail B; Cleveland-Rubeor, Hillary C; Yue, Yujuan; Schmidt, Kimberli A; Shao, Jason; Edlefsen, Paul T; Smedley, Jeremy; Kowalik, Timothy F; Stanton, Richard J; Axthelm, Michael K; Estes, Jacob D; Hansen, Scott G; Kaur, Amitinder; Barry, Peter A; Bimber, Benjamin N; Picker, Louis J; Streblow, Daniel N; Früh, Klaus; Malouli, Daniel. In vitro and in vivo characterization of a recombinant rhesus cytomegalovirus containing a complete genome. Plos Pathogens. 2020;16(11):e1008666.