Anti CD33 pAb (ATL-HPA035832)

Atlas Antibodies

Catalog No.:
ATL-HPA035832-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: CD33 molecule
Gene Name: CD33
Alternative Gene Name: FLJ00391, p67, SIGLEC-3, SIGLEC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030474: 36%, ENSRNOG00000037339: 35%
Entrez Gene ID: 945
Uniprot ID: P20138
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSEVRTQ
Gene Sequence KTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSEVRTQ
Gene ID - Mouse ENSMUSG00000030474
Gene ID - Rat ENSRNOG00000037339
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CD33 pAb (ATL-HPA035832)
Datasheet Anti CD33 pAb (ATL-HPA035832) Datasheet (External Link)
Vendor Page Anti CD33 pAb (ATL-HPA035832) at Atlas Antibodies

Documents & Links for Anti CD33 pAb (ATL-HPA035832)
Datasheet Anti CD33 pAb (ATL-HPA035832) Datasheet (External Link)
Vendor Page Anti CD33 pAb (ATL-HPA035832)
Citations for Anti CD33 pAb (ATL-HPA035832) – 1 Found
Yang, Bao; Yang, Chenlong; Fang, Jingyi; Yang, Jun; Xu, Yulun. Clinicoradiological characteristics, management and prognosis of primary myeloid sarcoma of the central nervous system: A report of four cases. Oncology Letters. 2017;14(3):3825-3831.  PubMed