Anti CD33 pAb (ATL-HPA035832)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035832-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CD33
Alternative Gene Name: FLJ00391, p67, SIGLEC-3, SIGLEC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030474: 36%, ENSRNOG00000037339: 35%
Entrez Gene ID: 945
Uniprot ID: P20138
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSEVRTQ |
Gene Sequence | KTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSEVRTQ |
Gene ID - Mouse | ENSMUSG00000030474 |
Gene ID - Rat | ENSRNOG00000037339 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CD33 pAb (ATL-HPA035832) | |
Datasheet | Anti CD33 pAb (ATL-HPA035832) Datasheet (External Link) |
Vendor Page | Anti CD33 pAb (ATL-HPA035832) at Atlas Antibodies |
Documents & Links for Anti CD33 pAb (ATL-HPA035832) | |
Datasheet | Anti CD33 pAb (ATL-HPA035832) Datasheet (External Link) |
Vendor Page | Anti CD33 pAb (ATL-HPA035832) |
Citations for Anti CD33 pAb (ATL-HPA035832) – 1 Found |
Yang, Bao; Yang, Chenlong; Fang, Jingyi; Yang, Jun; Xu, Yulun. Clinicoradiological characteristics, management and prognosis of primary myeloid sarcoma of the central nervous system: A report of four cases. Oncology Letters. 2017;14(3):3825-3831. PubMed |