Anti CD33 pAb (ATL-HPA035832)

Atlas Antibodies

Catalog No.: ATL-HPA035832-25

Protein Description: CD33 molecule
Gene Name: CD33
Alternative Gene Name: FLJ00391, p67, SIGLEC-3, SIGLEC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030474: 36%, ENSRNOG00000037339: 35%
Entrez Gene ID: 945
Uniprot ID: P20138
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSEVRTQ
• Gene Sequence: KTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSEVRTQ
• Gene ID - Mouse: ENSMUSG00000030474
• Gene ID - Rat: ENSRNOG00000037339
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CD33 pAb (ATL-HPA035832) – 1 Found

Yang, Bao; Yang, Chenlong; Fang, Jingyi; Yang, Jun; Xu, Yulun. Clinicoradiological characteristics, management and prognosis of primary myeloid sarcoma of the central nervous system: A report of four cases. Oncology Letters. 2017;14(3):3825-3831.