Anti CD300C pAb (ATL-HPA014523 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA014523-25
  • Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and CD300C over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY416481).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: CD300c molecule
Gene Name: CD300C
Alternative Gene Name: CMRF-35A, CMRF35, CMRF35A, IGSF16, LIR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044811: 35%, ENSRNOG00000046216: 36%
Entrez Gene ID: 10871
Uniprot ID: Q08708
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR
Gene Sequence PWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR
Gene ID - Mouse ENSMUSG00000044811
Gene ID - Rat ENSRNOG00000046216
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CD300C pAb (ATL-HPA014523 w/enhanced validation)
Datasheet Anti CD300C pAb (ATL-HPA014523 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD300C pAb (ATL-HPA014523 w/enhanced validation)